Cart summary

You have no items in your shopping cart.

LITAF Peptide - N-terminal region

SKU: orb2002586

Description

LITAF Peptide - N-terminal region

Images & Validation

Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with LITAF Rabbit Polyclonal Antibody (orb331449). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

Protein SequenceSynthetic peptide located within the following region: PSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN

Storage & Handling

StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

LITAF,PIG7,SIMPLE,
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

LITAF Peptide - N-terminal region (orb2002586)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 200.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry