LIPA Rabbit Polyclonal Antibody

• Catalog Number: orb326386
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LIPA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LIPA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: LIPA
• UniProt ID: P38571
• Protein Sequence: Synthetic peptide located within the following region: SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD
• NCBI: NP_000226
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CESD antibody, anti LAL antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-LIPA Antibody, Titration: 1.0 ug/mL, Positive Control: HepG2 Whole Cell, LIPA is supported by BioGPS gene expression data to be expressed in HepG2.