You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575105 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LIN28 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LIN28 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 23kDa |
Target | LIN28A |
UniProt ID | Q9H9Z2 |
Protein Sequence | Synthetic peptide located within the following region: GSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRM |
NCBI | NP_078950 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CSDD1, LIN28, LIN-28, ZCCHC1, lin-28A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-LIN28 antibody (orb575105).
WB Suggested Anti-LIN28 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.
FC, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |