LEPROTL1 antibody

• Catalog Number: orb326676
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LEPROTL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LEPROTL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 14kDa
• Target: LEPROTL1
• UniProt ID: O95214
• Protein Sequence: Synthetic peptide located within the following region: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI
• NCBI: NP_056159
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSPC112 antibody, anti Vps55 antibody, anti m
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human 721_B tissue using LEPROTL1 antibody

Western blot analysis of human Hela tissue using LEPROTL1 antibody

Western blot analysis of human Fetal Liver tissue using LEPROTL1 antibody

Western blot analysis of human HepG2 tissue using LEPROTL1 antibody