Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

LEPROTL1 Rabbit Polyclonal Antibody

SKU: orb326676

Description

Rabbit polyclonal antibody to LEPROTL1

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human LEPROTL1
TargetLEPROTL1
Protein SequenceSynthetic peptide located within the following region: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI
Molecular Weight14kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HSPC112 antibody, anti Vps55 antibody, anti my047 antibody

Similar Products

  • LEPROTL1 Rabbit Polyclonal Antibody (HRP) [orb483096]

    IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • LEPROTL1 Rabbit Polyclonal Antibody [orb184902]

    ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • LEPROTL1 Rabbit Polyclonal Antibody (Biotin) [orb461039]

    ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • LEPROTL1 Rabbit Polyclonal Antibody (APC) [orb1002362]

    ICC,  IF

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Rabbit

    Polyclonal

    APC

    100 μl
  • LEPROTL1 Rabbit Polyclonal Antibody (RBITC) [orb1072070]

    ICC,  IF

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Rabbit

    Polyclonal

    RBITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

LEPROTL1 Rabbit Polyclonal Antibody

Sample Type: Fetal Liver lysates, Antibody Dilution: 1.0 ug/mL.

LEPROTL1 Rabbit Polyclonal Antibody

Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is supported by BioGPS gene expression data to be expressed in 721_B.

LEPROTL1 Rabbit Polyclonal Antibody

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is supported by BioGPS gene expression data to be expressed in HeLa.

LEPROTL1 Rabbit Polyclonal Antibody

Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_056159

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

LEPROTL1 Rabbit Polyclonal Antibody (orb326676)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry