You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| MW | 4585.36 |
| Purity | ≥95% |
| Formula | C191H320N64O57S5 |
| Protein Sequence | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAEQ |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
LEAP-2 (38 - 77) (Human) (orb2693734)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Lead Time: please enquire