You have no items in your shopping cart.
Cart summary
Item 1 of 1
LAX1 Rabbit Polyclonal Antibody
Catalog Number: orb331019
Product Properties
| Catalog Number | orb331019 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to LAX1 |
| Target | LAX1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Canine, Mouse, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LAX1 |
| Protein Sequence | Synthetic peptide located within the following region: ADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLL |
| UniProt ID | B7Z744 |
| MW | 42kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FLJ20340 antibody, anti LAX antibody |
| Research Area | Cell Biology, Molecular Biology, Protein Biochemis Read more... |
| Note | For research use only |
| NCBI | NP_001129662 |
Images
WB Suggested Anti-LAX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, LAX1 is supported by BioGPS gene expression data to be expressed in Jurkat.
Similar Products
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
Reviews
LAX1 Rabbit Polyclonal Antibody (orb331019)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review