LAPTM4B Rabbit Polyclonal Antibody

• Catalog Number: orb580056
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LAPTM4B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LAPTM4B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35 kDa
• Target: LAPTM4B
• UniProt ID: Q86VI4
• Protein Sequence: Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS
• NCBI: NP_060877
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LC27, LAPTM4beta
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody dilution: 1 ug/ml.

Rabbit Anti-LAPTM4B Antibody, Catalog Number: orb580056, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Membrane and cytoplasmic in processes of pinealocytes and intersticial cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-LAPTM4B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. There is BioGPS gene expression data showing that LAPTM4B is expressed in HEK293T.