You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583378 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KRCC1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Equine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KRCC1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31kDa |
Target | KRCC1 |
UniProt ID | Q9NPI7 |
Protein Sequence | Synthetic peptide located within the following region: KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR |
NCBI | NP_057702 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CHBP2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. KRCC1 is supported by BioGPS gene expression data to be expressed in 721_B.
WB Suggested Anti-KRCC1 Antibody Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate. KRCC1 is supported by BioGPS gene expression data to be expressed in ACHN.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating