Klhl26 Rabbit Polyclonal Antibody

• Catalog Number: orb575154
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Klhl26
• Target: Klhl26
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Klhl26
• Protein Sequence: Synthetic peptide located within the following region: GQLLDVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGV
• UniProt ID: Q8BGY4
• MW: 67kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Klkl26, C630013N10Rik
• Note: For research use only
• NCBI: NP_848886
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse Liver lysates, Antibody dilution: 1.0 ug/ml.