You have no items in your shopping cart.
Cart summary
Item 1 of 1
KIR3DL2 Rabbit Polyclonal Antibody
Catalog Number: orb55758
| Catalog Number | orb55758 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KIR3DL2. |
| Target | KIR3DL2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen for Anti-KIR3DL2 antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2 |
| Protein Sequence | Synthetic peptide located within the following region: IFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTY |
| UniProt ID | P43630 |
| MW | 50 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | 3DL2, p140, NKAT4, CD158K, NKAT-4, NKAT4B, KIR-3DL Read more... |
| Note | For research use only |
| NCBI | NP_006728.2 |
WB Suggested Anti-KI3L2 antibody Titration: 1 ug/ml, Sample Type: Human Ovary Tumor.
- Item 1 of 2
- Item 1 of 1
