Cart summary

You have no items in your shopping cart.

    KIF5A Antibody - middle region : Biotin

    KIF5A Antibody - middle region : Biotin

    Catalog Number: orb2135897

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2135897
    CategoryAntibodies
    DescriptionKIF5A Antibody - middle region : Biotin
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KIF5A
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationBiotin
    MW117kDa
    UniProt IDQ12840
    Protein SequenceSynthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH
    NCBINP_004975
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesNKHC, ALS25, MY050, NEIMY, SPG10, D12S1889
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars