Cart summary

You have no items in your shopping cart.

KIAA1333 Rabbit Polyclonal Antibody (FITC)

KIAA1333 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2121015

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2121015
CategoryAntibodies
DescriptionKIAA1333 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KIAA1333
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW80kDa
UniProt IDQ7L622
Protein SequenceSynthetic peptide located within the following region: IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR
NCBINP_060239
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPHF7B, KIAA1333
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.