You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575529 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCTD13 |
Target | KCTD13 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD13 |
Protein Sequence | Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE |
UniProt ID | Q8WZ19 |
MW | 36 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PDIP1, FKSG86, BACURD1, POLDIP1, hBACURD1 |
Note | For research use only |
NCBI | NP_849194 |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Kidney (KI), Antibody concentration: 3 ug/ml.
Human Brain
WB Suggested Anti-KCTD13 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human heart.
WB | |
Mouse, Other, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
IHC, WB | |
Bovine, Canine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |