KCTD13 Rabbit Polyclonal Antibody

• Catalog Number: orb575529
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCTD13
• Target: KCTD13
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD13
• Protein Sequence: Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
• UniProt ID: Q8WZ19
• MW: 36 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PDIP1, FKSG86, BACURD1, POLDIP1, hBACURD1
• Research Area: Pharmacology & Drug Discovery
• Note: For research use only
• NCBI: NP_849194
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Kidney (KI), Antibody concentration: 3 ug/ml.

Human Brain

WB Suggested Anti-KCTD13 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human heart.