You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb575441 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KCNJ12 |
| Target | KCNJ12 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KCNJ12 |
| Protein Sequence | Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR |
| UniProt ID | Q14500 |
| MW | 49kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | IRK2, hIRK, IRK-2, hIRK1, KCNJN1, Kir2.2, Kir2.2v, Read more... |
| Research Area | Cell Biology, Pharmacology & Drug Discovery |
| Note | For research use only |
| NCBI | NP_066292 |

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.1 ug/ml of the antibody was used in this experiment.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Pancreas, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Stomach, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-KCNJ12 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.
ELISA, FC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
RBITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review