Cart summary

You have no items in your shopping cart.

KCNJ12 Rabbit Polyclonal Antibody

SKU: orb575441

Description

Rabbit polyclonal antibody to KCNJ12

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KCNJ12
TargetKCNJ12
Protein SequenceSynthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR
Molecular Weight49kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IRK2, hIRK, IRK-2, hIRK1, KCNJN1, Kir2.2, Kir2.2v, kcnj12x, hkir2.2x

Similar Products

  • KCNJ12 Rabbit Polyclonal Antibody [orb628276]

    ELISA,  FC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • KCNJ12 Rabbit Polyclonal Antibody (FITC) [orb2133652]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
  • KCNJ12 Rabbit Polyclonal Antibody (Biotin) [orb2133650]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • KCNJ12 Rabbit Polyclonal Antibody (HRP) [orb2133651]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • Kir2.2 Rabbit Polyclonal Antibody (HRP) [orb472492]

    ELISA,  IHC-Fr,  IHC-P,  WB

    Human

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

KCNJ12 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.1 ug/ml of the antibody was used in this experiment.

KCNJ12 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

KCNJ12 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

KCNJ12 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

KCNJ12 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

KCNJ12 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

KCNJ12 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

KCNJ12 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Pancreas, Antibody dilution: 1.0 ug/ml.

KCNJ12 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Stomach, Antibody dilution: 1.0 ug/ml.

KCNJ12 Rabbit Polyclonal Antibody

Rabbit Anti-KCNJ12 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

KCNJ12 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_066292

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

KCNJ12 Rabbit Polyclonal Antibody (orb575441)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry