Cart summary

You have no items in your shopping cart.

KCNB1 Rabbit Polyclonal Antibody

SKU: orb574895

Description

Rabbit polyclonal antibody to KCNB1

Research Area

Cardiovascular Research, Cell Biology, Pharmacology & Drug Discovery

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KCNB1
TargetKCNB1
Protein SequenceSynthetic peptide located within the following region: YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT
Molecular Weight96 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DRK1, DEE26, Kv2.1

Similar Products

  • Kv2.1/KCNB1 Rabbit Polyclonal Antibody [orb196281]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Kv2.1 (phospho Ser567) rabbit pAb Antibody [orb768867]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • KV2.1 (phospho Ser805) rabbit pAb Antibody [orb768866]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Kv2.1 rabbit pAb Antibody [orb768868]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Kv2.1/KCNB1 rabbit pAb Antibody [orb771771]

    IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

KCNB1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recognizes the canonical isoform 1 (~96 kDa) & also a smaller isoform at 89 kDa in some samples. Recommended dilution is 1-3 ug/ml for this antibody.

KCNB1 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004966

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

KCNB1 Rabbit Polyclonal Antibody (orb574895)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry