Cart summary

You have no items in your shopping cart.

KALRN Peptide - middle region

KALRN Peptide - middle region

Catalog Number: orb2000935

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2000935
CategoryProteins
DescriptionKALRN Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: QGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLAARQ
UniProt IDO60229
MW81 kDa
Tested applicationsWB
Application notesThis is a synthetic peptide designed for use in combination with KALRN Rabbit Polyclonal Antibody (orb589150). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesDUO, CHD5, DUET, TRAD, CHDS5, HAPIP, ARHGEF24
NoteFor research use only
NCBINP_001019831.2