You have no items in your shopping cart.
Cart summary
IL9R Peptide - middle region
Catalog Number: orb1999929
| Catalog Number | orb1999929 |
|---|---|
| Category | Proteins |
| Description | IL9R Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 55 kDa |
| UniProt ID | Q01113 |
| Protein Sequence | Synthetic peptide located within the following region: LPAGCTEWRVQTLAYLPQEDWAPTSLTRPAPPDSEGSRSSSSSSSSNNNN |
| NCBI | NP_002177.2 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | CD129, IL-9R Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with IL9R Rabbit Polyclonal Antibody (orb590054). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
