You have no items in your shopping cart.
Cart summary
IL6 Peptide - middle region
Catalog Number: orb2000795
| Catalog Number | orb2000795 |
|---|---|
| Category | Proteins |
| Description | IL6 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL |
| UniProt ID | P05231 |
| MW | 23 kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with IL6 Rabbit Polyclonal Antibody (orb582293). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CDF, HGF, HSF, BSF2, IL-6, BSF-2, IFNB2, IFN-beta- Read more... |
| Note | For research use only |
| NCBI | NP_000591 |
