You have no items in your shopping cart.
Cart summary
IL20RA Peptide - middle region
Catalog Number: orb1998850
| Catalog Number | orb1998850 |
|---|---|
| Category | Proteins |
| Description | IL20RA Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: LNDPQPSGNLRPPQEEEEVKHLGYASHLMEIFCDSEENTEGTSLTQQESL |
| UniProt ID | Q9UHF4 |
| MW | 60 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CRF2-8, IL-20R1, IL-20RA, IL-20R-alpha |
| Note | For research use only |
| NCBI | NP_001265651.1 |
