Cart summary

You have no items in your shopping cart.

IL20RA Peptide - middle region

IL20RA Peptide - middle region

Catalog Number: orb1998850

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998850
CategoryProteins
DescriptionIL20RA Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: LNDPQPSGNLRPPQEEEEVKHLGYASHLMEIFCDSEENTEGTSLTQQESL
UniProt IDQ9UHF4
MW60 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesCRF2-8, IL-20R1, IL-20RA, IL-20R-alpha
NoteFor research use only
NCBINP_001265651.1