You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2010282 |
---|---|
Category | Proteins |
Description | IL17A Peptide - N-terminal region |
Tested applications | WB |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
MW | 15kDa |
UniProt ID | Q16552 |
Protein Sequence | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLN |
NCBI | NP_002181 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | CTLA8, IL-17, IL-17A, IL17 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |