You have no items in your shopping cart.
IL-1b (178-207) (human)
SKU: orb2694544
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| Molecular Weight | 3492.07 |
| Protein Sequence | LKEYNLYLSCVLKDDKPTLQLESVDPKNYP |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
IL-1b (178-207) (human) (orb2694544)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review