You have no items in your shopping cart.
IL 1 beta Protein
SKU: orb426423
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg. |
| Protein Sequence | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
| Purity | Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4, 5% trehalose and 0.02 % Tween-20. |
| Disclaimer | For research use only |
Alternative Names
−Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Similar Products
−IL-8/CXCL8 Rabbit Polyclonal Antibody [orb10915]
ELISA, WB
Bovine, Porcine, Rabbit, Sheep
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlHuman Interleukin 18 Receptor Accessory Protein (IL18RAP) ELISA Kit [orb777337]
Human
0.16-10 ng/mL
0.053 ng/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
IL 1 beta Protein (orb426423)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




















