IL28B Rabbit Polyclonal Antibody

• Catalog Number: orb585739
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL28B
• Target: IFNL3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: PRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDL
• UniProt ID: Q8IZI9
• MW: 22kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: IL28B, IL28C, IL-28B, IL-28C, IFN-lambda-3, IFN-la
• Research Area: Immunology & Inflammation
• Note: For research use only
• NCBI: NP_742151
• Expiration Date: 12 months from date of receipt.

Sample Type: Fetal Lung, Antibody dilution: 1.0 ug/ml.