IDS Rabbit Polyclonal Antibody

• Catalog Number: orb333732
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Iduronate 2 sulfatase
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IDS
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 59kDa
• Target: IDS
• UniProt ID: P22304
• Protein Sequence: Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE
• NCBI: NP_000193
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Alpha L iduronate sulfate sulfatase antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): MCF7 (N10), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.

WB Suggested Anti-IDS Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.