IDS Rabbit Polyclonal Antibody

SKU: orb333732

Description

Rabbit polyclonal antibody to Iduronate 2 sulfatase

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IDS
• Target: IDS
• Protein Sequence: Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE
• Molecular Weight: 59kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Alpha L iduronate sulfate sulfatase antibody, anti Alpha-L-iduronate sulfate sulfatase antibody, anti Ids antibody, anti Iduronate 2 sulfatase 14 kDa chain antibody, anti Iduronate 2 sulfatase 42 kDa chain antibody, anti Iduronate 2 sulfatase antibody, anti Iduronate 2-sulfatase 14 kDa chain antibody, anti Iduronate sulfatase antibody, anti Idursulfase antibody, anti SIDS antibody

Positive control (+): MCF7 (N10), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.

WB Suggested Anti-IDS Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.

Quick Database Links

Gene Symbol

IDS

UniProt

P22304

RefSeq (Protein):NP_000193