You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333732 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Iduronate 2 sulfatase |
Target | IDS |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IDS |
Protein Sequence | Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE |
UniProt ID | P22304 |
MW | 59kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti Alpha L iduronate sulfate sulfatase antibody, Read more... |
Note | For research use only |
NCBI | NP_000193 |
Positive control (+): MCF7 (N10), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.
WB Suggested Anti-IDS Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Cy3 |
IF | |
Bovine, Canine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
PerCP/Cy5.5 |
IF | |
Bovine, Canine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
PerCP |