ICAM1 Peptide - N-terminal region

• Catalog Number: orb2010304
• Category: Proteins
• Description: ICAM1 Peptide - N-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: LLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELA
• UniProt ID: P05362
• MW: 59kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with ICAM1 Rabbit Polyclonal Antibody (orb584229). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: BB2, CD54, P3.58, ICAM-1, ICAM1
• Note: For research use only
• NCBI: NP_000192
• Expiration Date: 6 months from date of receipt.