You have no items in your shopping cart.
Human VSIG4 Protein
SKU: orb1476714
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody, the EC50 is 51.14-68.73 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 30.6 kDa |
| Expression Region | 20-283aa |
| Protein Length | Partial |
| Protein Sequence | RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(Protein Z39Ig)
Similar Products
−
Human VSIG4 [orb2993971]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 56.3 KDa. Observed: 75 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman VSIG4 [orb2995000]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 30.2 KDa. Observed: 37-68 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 1
Human VSIG4(V-set And Immunoglobulin Domain-containing Protein 4) ELISA Kit [orb3127160]
Human
31.25-2000 pg/mL
11.4 pg/mL
48 T, 96 T - Item 1 of 1
- Item 1 of 1
Human VSIG4 Protein, hFc Tag [orb1173745]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 55.3 kDa after removal of the signal peptide. The apparent molecular mass of VSIG4-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody, the EC50 is 51.14-68.73 ng/mL.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human VSIG4 Protein (orb1476714)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days