You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Human VSIG4 Protein
Catalog Number: orb1476714
| Catalog Number | orb1476714 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human V-set and immunoglobulin domain-containing protein 4(VSIG4),partial (Active) |
| Tag | C-terminal 10xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP |
| Protein Length | Partial |
| UniProt ID | Q9Y279 |
| MW | 30.6 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody, the EC50 is 51.14-68.73 ng/mL. |
| Expression Region | 20-283aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | (Protein Z39Ig) |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody, the EC50 is 51.14-68.73 ng/mL.
- Item 1 of 1
Human VSIG4 Protein, hFc Tag [orb1173745]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 55.3 kDa after removal of the signal peptide. The apparent molecular mass of VSIG4-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg 
Human VSIG4 protein [orb392707]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman VSIG4 protein [orb392708]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman VSIG4 ELISA Kit [orb405547]
Human
31.25 pg/mL-2000 pg/mL
7.81 pg/mL
5 x 96 T, 48 T, 10 x 96 T, 96 T, 24 T
