You have no items in your shopping cart.
Human VSIG4 Protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody, the EC50 is 51.14-68.73 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 30.6 kDa |
| Expression Region | 20-283aa |
| Protein Length | Partial |
| Protein Sequence | RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human VSIG4 [orb2993971]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 56.3 KDa. Observed: 75 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman VSIG4 [orb2995000]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 30.2 KDa. Observed: 37-68 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman VSIG4(V-set And Immunoglobulin Domain-containing Protein 4) ELISA Kit [orb3127160]
Human
31.25-2000 pg/mL
11.4 pg/mL
48 T, 96 TVSIG4 (NM_007268) Human Recombinant Protein [orb3050570]
> 80% as determined by SDS-PAGE and Coomassie blue staining
43.8 kDa
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody, the EC50 is 51.14-68.73 ng/mL.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human VSIG4 Protein (orb1476714)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

