You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419218 |
---|---|
Category | Proteins |
Description | Recombinant Human Versican core |
Tag | N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 47.6 kDa |
UniProt ID | P13611 |
Protein Sequence | GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 3089-3354aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Chondroitin sulfate proteoglycan core protein 2 Read more... |
Note | For research use only |
Application notes | Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-taggedExpression Region: 3089-3354aaSequence Info: Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 85% as determined by SDS-PAGE. | |
34.6 kDa | |
Baculovirus |
ELISA, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Biotin |