Human VEGF (121 a.a.) (Sf9) Protein

• Catalog Number: orb429177
• Category: Proteins
• Description: Recombinant of human VEGF (121 a.a.) (Sf9) protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Solubility (25°C): The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50µg/ml.
• Protein Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR
• Source: Sf9, Insect Cells
• Biological Activity: Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml.
• Storage: Stability: Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Buffer/Preservatives: The protein was lyophilized from a solution containing 50mM acetic acid.
• Alternative names: Vascular endothelial growth factor A, VEGF-A, Vasc
• Note: For research use only
• Application notes: Cytokines And Growth Factors
• Expiration Date: 6 months from date of receipt.