You have no items in your shopping cart.
Human TSLP protein (Active)
SKU: orb359032
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-7Rα and human TSLP R co-transfected murine BaF3 pro-B cells is less than 0.3 ng/ml, corresponding to a specific activity of > 3.3 x 10 ^ 6 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 15.1 kDa |
| Expression Region | 29-159aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | M+YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150 mM NaCl |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active) [orb2985925]
Greater than 90% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.
52.9 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Cytokine receptor-like factor 2 (CRLF2), partial, Biotinylated (Active) [orb2986016]
Greater than 95% as determined by SDS-PAGE.
28.6 kDa
Mammalian cell
100 μg, 1 mg, 20 μgRecombinant Human Thymic stromal lymphopoietin protein(TSLP) (Active) [orb1650507]
>98% as determined by SDS-PAGE and HPLC.
15.1 kDa
100 μg, 500 μg, 10 μg, 250 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Human TSLP protein (Active) (orb359032)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review