Human TSLP protein (Active)

SKU: orb359032

Description

This Human TSLP protein (Active) spans the amino acid sequence from region 29-159aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-7Rα and human TSLP R co-transfected murine BaF3 pro-B cells is less than 0.3 ng/ml, corresponding to a specific activity of ＞ 3.3 x 10 ^ 6 IU/mg.
• Tag: Tag-Free
• Expression Region: 29-159aa
• Protein Length: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 15.1 kDa
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• Protein Sequence: M+YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150 mM NaCl
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

SDS-PAGE gel analysis of orb359032.

Quick Database Links

UniProt

Q969D9