Human TRX protein

• Catalog Number: orb594908
• Category: Proteins
• Description: Recombinant Human Thioredoxin(TXN) (Active)
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 13.9 kDa
• UniProt ID: P10599
• Protein Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
• Protein Length: Full Length
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its ability to catalyze the reduction of insulin.The reaction leads to precipitation, which can be measured by absorbance at 650 nm. The specific activity is 0.2-1 Abs/min/mg as measured under the described conditions.
• Expression Region: 1-105aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Alternative names: Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface
• Note: For research use only
• Application notes: Full Length
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.