Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human TRPV1 Protein

SKU: orb1477112

Description

This Human TRPV1 Protein spans the amino acid sequence from region 1-155aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Neuroscience

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceE.coli
Biological OriginHomo sapiens (Human)
TagN-terminal 6xHis-GST-tagged
Expression Region1-155aa
Protein LengthPartial
MW69.3 kDa
PurityGreater than 85% as determined by SDS-PAGE.
Protein SequenceVLFQGPLGSPEFRTMKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQR PGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSI TPWGLTGLEGFFAERRNYIRIGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAGFPRQALNRGLPLGFRFSALRHLDPKNLIRVMVHV VAIALIDGFRPLTWSPRSLWTLSKLDTLTLSSVYSFDYKDFADSGL

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLiquid or Lyophilized powder
Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

(TrpV1)(Capsaicin receptor)(Osm-9-like TRP channel 1)(OTRPC1)(Vanilloid receptor 1)

Similar Products

  • TRPV1 Antibody [orb51846]

    ELISA,  IF,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Human TRPV1 full length protein-synthetic nanodisc [orb1743143]

    Unconjugated

    The human full length TRPV1 protein has a MW of 95.0 kDa

    Mammalian

    100 μg, 10 μg, 50 μg
  • Recombinant Human TRPV1 Protein, N-His [orb2967590]

    ELISA,  SDS-PAGE,  WB

    >90% as determined by SDS-PAGE.

    18.9 kDa

    1 mg, 50 μg, 100 μg
  • Human TrpV1 Protein [orb1476366]

    500 μg, 50 μg
  • Human TRPV1 Protein, hFc Tag [orb2668318]

    Unconjugated

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 35.2 kDa after removal of the signal peptide. The apparent molecular mass of hFc-TRPV1 is approximately 35-70 kDa due to glycosylation.

    100 μg, 10 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human TRPV1 Protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human TRPV1 Protein (orb1477112)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 330.00
100 μg
$ 600.00
1 mg
$ 2,490.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry