Cart summary

You have no items in your shopping cart.

    Human TRPV1 Protein

    Human TRPV1 Protein

    Catalog Number: orb1477112

    DispatchUsually dispatched within 5-10 working days
    $ 2,400.00
    Catalog Numberorb1477112
    CategoryProteins
    DescriptionRecombinant Human Transient receptor potential cation channel subfamily V member 1(TRPV1),partial
    TagN-terminal 6xHis-GST-tagged
    Form/AppearanceLiquid or Lyophilized powder
    PurityGreater than 85% as determined by SDS-PAGE.
    MW69.3 kDa
    UniProt IDQ8NER1
    Protein SequenceVLFQGPLGSPEFRTMKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQR PGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSI TPWGLTGLEGFFAERRNYIRIGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAGFPRQALNRGLPLGFRFSALRHLDPKNLIRVMVHV VAIALIDGFRPLTWSPRSLWTLSKLDTLTLSSVYSFDYKDFADSGL
    Protein LengthPartial
    SourceE.coli
    Expression SystemExpression Region: 1-155aa. Protein Length: Partial
    EndotoxinsNot test.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
    Alternative names(TrpV1)(Capsaicin receptor)(Osm-9-like TRP channel
    Read more...
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars