Human TR10B protein (Active)

• Catalog Number: orb359199
• Category: Proteins
• Description: Recombinant human TR10B active protein
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Protein Sequence: ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES
• Protein Length: Partial
• UniProt ID: O14763
• MW: 14.8 kDa
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. rHusTRAIL-R2 reduced the production of LPS- induced TNF by its ability to neutralize endogenous TRAIL in fresh human PBMC. In this assay, endogenous TRAIL is induced during a 24 hour exposure to LPS (10 ng/mL) but in the presence of rHusTRAIL-R2, TRAIL-induced TNF is suppressed.
• Expression Region: 52-183aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Death receptor 5, TRAIL receptor 2, TRAIL-R2, CD a
• Research Area: Cancer Biology
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Human TR10B protein (Active)