Human TNR11 protein (Active)

• Catalog Number: orb359202
• Category: Proteins
• Description: Recombinant human TNR11 active protein
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• MW: 19.1 kDa
• UniProt ID: Q9Y6Q6
• Protein Sequence: QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
• Protein Length: Partial
• Source: E.Coli
• Expression System: Expression Region: 29-202aa. Protein Length: Partial
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit sRANK Ligand induced nuclear factor kappa B(NFkappaB) in RAW 264.7 cells is less than 50 ng/ml, corresponding to a specific activity of ＞ 2.0 × 104 IU/mg in the presence of 15 ng/ml of recombinant sRANK Ligand.
• Expression Region: 29-202aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, pH 8.0, 150mM NaCl
• Alternative names: Osteoclast differentiation factor receptor, Recept
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Human TNR11 protein (Active)