Human TNR11 protein (Active)

SKU: orb359202

Description

This Human TNR11 protein (Active) spans the amino acid sequence from region 29-202aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit sRANK Ligand induced nuclear factor kappa B(NFkappaB) in RAW 264.7 cells is less than 50 ng/ml, corresponding to a specific activity of ＞ 2.0 x 10 ^ 4 IU/mg in the presence of 15 ng/ml of recombinant sRANK Ligand.
• Tag: Tag-Free
• Molecular Weight: 19.1 kDa
• Expression Region: 29-202aa
• Protein Length: Partial
• Protein Sequence: QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, pH 8.0, 150mM NaCl
• Disclaimer: For research use only

Alternative Names

Osteoclast differentiation factor receptor, Receptor activator of NF-KB, CD antigen CD265

SDS-PAGE analysis of Human TNR11 protein (Active)

Quick Database Links

UniProt

Q9Y6Q6