You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358130 |
---|---|
Category | Proteins |
Description | Recombinant human TNFSF12 protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Protein Length | Extracellular Domain |
UniProt ID | O43508 |
MW | 38.9 kDa |
Application notes | Full length of Extracellular domain of His-SUMO-tag and expression region is 43-149aa |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 43-249aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | APO3 ligandTNF-related weak inducer of apoptosis , Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 43.3 kDa after removal of the signal peptide. | |
Mammalian |
Human | |
0.312 ng/ml-20 ng/ml | |
0.078 ng/ml |
> 90% as determined by SDS-PAGE. | |
25.95 kDa |
> 90% as determined by SDS-PAGE. | |
22.66 kDa |
> 85% as determined by SDS-PAGE |