You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594868 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 18.1 kDa |
UniProt ID | Q07011 |
Protein Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Protein Length | Extracellular Domain |
Source | Mammalian cell |
Expression System | Expression Region: 24-186aa. Protein Length: Extracellular Domain |
Biological Activity | The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml. |
Expression Region | 24-186aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137 Read more... |
Note | For research use only |
Application notes | Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
19.2 kDa | |
Cynomolgus / Rhesus macaque 4-1BB, His Tag (orb334873) is expressed from human 293 cells (HEK293). It contains AA Leu 24 - Gln 186 (Accession # XP_005544945.1). |
Unconjugated | |
95% | |
43.4 kDa | |
Human 4-1BB, Fc Tag (orb257164) is expressed from human 293 cells (HEK293). It contains AA Leu 24 - Gln 186 (Accession # NP_001552.2). |
Unconjugated | |
95% | |
21.9 kDa | |
Mouse 4-1BB, His Tag (orb348784) is expressed from human 293 cells (HEK293). It contains AA Val 24 - Leu 211 (Accession # NP_001070976.1). |
Unconjugated | |
90% | |
46.7 kDa | |
Mouse 4-1BB, Fc Tag (orb334874) is expressed from human 293 cells (HEK293). It contains AA Val 24 - Leu 211 (Accession # Q8R037-1). |
Greater than 95% as determined by SDS-PAGE. | |
44 kDa | |
Mammalian cell |
Filter by Rating