You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594867 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active) |
Tag | C-terminal 6xHis-Fc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 44 kDa |
UniProt ID | Q07011 |
Protein Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Protein Length | Extracellular Domain |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BB-Fc-His at 2μg/ml can bind Anti-Human CD137 mAb, the ED50 of Anti-Human CD137 mAb is 0.41ug/ml. |
Expression Region | 24-186aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | CD137;ILA;TNFRSF9;4-1BB ligand receptor;CDw137;T-c Read more... |
Note | For research use only |
Application notes | Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 35-45 kDa based on Tris-Bis PAGE result. |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide. The apparent molecular mass of c4-1BB-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Greater than 95% as determined by SDS-PAGE. | |
18.1 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
44.2 kDa | |
Mammalian cell |