Human TNFRSF9 protein

Catalog Number: orb594867

Catalog Number	orb594867
Category	Proteins
Description	Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)
Tag	C-terminal 6xHis-Fc-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	44 kDa
UniProt ID	Q07011
Protein Sequence	LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Protein Length	Extracellular Domain
Source	Mammalian cell
Expression System	Expression Region: 24-186aa. Protein Length: Extracellular Domain
Biological Activity	The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.
Expression Region	24-186aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alternative names	CD137;ILA;TNFRSF9;4-1BB ligand receptor;CDw137;T-c Read more...
Note	For research use only
Application notes	Extracellular Domain
Expiration Date	6 months from date of receipt.

Item 1 of 2

Conjugation:	Unconjugated
Purity:	90%
MW:	19.2 kDa
Source:	Cynomolgus / Rhesus macaque 4-1BB, His Tag (orb334873) is expressed from human 293 cells (HEK293). It contains AA Leu 24 - Gln 186 (Accession # XP_005544945.1).

Sizes Available: 1 mg, 100 μg

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	18.1 kDa
Source:	Mammalian cell