You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605392 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 22.7 kDa |
UniProt ID | P19438 |
Protein Sequence | IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT |
Protein Length | Partial |
Source | Yeast |
Expression System | Expression Region: 22-211aa. Protein Length: Partial |
Expression Region | 22-211aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Tumor necrosis factor receptor 1 (TNF-R1) (Tumor n Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
98% | |
47.9 kDa | |
Human TNFR1, Fc Tag (orb257878) is expressed from human 293 cells (HEK293). It contains AA Ile 22 - Thr 211 (Accession # NP_001056). |
Human | |
78.125 pg/mL-5000 pg/mL | |
65 pg/mL |
Greater than 90% as determined by SDS-PAGE. | |
47.2 kDa | |
E.coli |
Filter by Rating