You have no items in your shopping cart.
Human Tnfrsf17 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml. |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 34.8 kDa |
| Expression Region | 1-54aa |
| Protein Length | Partial |
| Protein Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Tumor Necrosis Factor Receptor Superfamily, Member 17 (TNFRSF17) ELISA Kit [orb1817288]
Human
0.16-10 ng/mL
0.071 ng/mL
48 T, 96 TRecombinant Human FITC-Labeled BCMA Protein [orb2992829]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 9.6 KDa. Observed: 15&16-19 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μgBCMA Cynomolgus Recombinant Protein (Biotin) [orb2992901]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 35 KDa. Observed: 37-47 KDa
100 μg, 20 μgRecombinant Human BCMA Protein [orb2993882]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 7.7 KDa. Observed: (11-14)&(16-26) KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human BCMA Protein (Biotin) [orb2993933]
Biotin
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 34.6 KDa. Observed: 38-45 KDa, reducing conditions
20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 10 μg/ml can bind human BCMA, the EC50 of human BCMA protein is 221.3-298.6 ng/ml.

Human TNFSF13B protein Fc tag captured on COOH chip can bind Human BCMA protein Fc tag with an affinity constant of 39 nM as detected by LSPR Assay.

Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 μg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.1752-0.3657 ng/ml.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human Tnfrsf17 protein (orb624119)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
