You have no items in your shopping cart.
Cart summary
Human TNFRSF10C protein
Catalog Number: orb594850
| Catalog Number | orb594850 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 21.78 kDa |
| UniProt ID | O14798 |
| Protein Sequence | ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA |
| Protein Length | Partial |
| Source | Mammalian cell |
| Expression System | Expression Region: 26-221aa. Protein Length: Partial |
| Biological Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TRAIL is less than 200 ng/ml. |
| Expression Region | 26-221aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Alternative names | Tumor Necrosis Factor Receptor Superfamily Member Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
Human TNFRSF10C protein [orb392586]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman TNFRSF10C protein [orb392587]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human CD263/TNFRSF10C Protein, His Tag [orb1553210]
≥90% as determined by SDS-PAGE
This protein contains the human TNFRSF10C(Met1-Ala221) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human TNFRSF10C Protein, His Tag [orb1551514]
≥90% as determined by SDS-PAGE
This protein contains the human TNFRSF10C(Ala26-Ala221) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human TNFRSF10C C-fc Protein, Fc & His Tag [orb1551515]
≥90% as determined by SDS-PAGE
This protein contains the human TNFRSF10C(Ala26-Ala221) was fused with the C-terminal Fc Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars