Human TNFRSF10C protein

• Catalog Number: orb594850
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
• Protein Length: Partial
• UniProt ID: O14798
• MW: 21.78 kDa
• Application notes: Partial
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 0.56 ng/ml.
• Expression Region: 26-221aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Tumor Necrosis Factor Receptor Superfamily Member
• Research Area: Cancer Biology
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.