You have no items in your shopping cart.
Human TNFR2 Protein (His Tag)
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered clear solution. |
| Buffer/Preservatives | TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human TNFRSF1B Protein, His Tag [orb1743294]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 26.0 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-His is approximately 35-55 kDa due to glycosylation.
E.coli
100 μg, 50 μg, 10 μgRecombinant Human BIRC3 Protein, N-His [orb2965862]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
21.07 kDa
1 mg, 50 μg, 100 μgRecombinant Human CD120b/TNFRSF1B/TNFR2 Protein, C-His [orb2966424]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
28.30 kDa
1 mg, 50 μg, 100 μgRecombinant Human CD120b/TNFRSF1B/TNFR2 Protein, N-His [orb2968973]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
27.42 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Request a Document
Protocol Information
Human TNFR2 Protein (His Tag) (orb80625)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
