You have no items in your shopping cart.
Cart summary
Human TNFR2 Protein (His Tag)
Catalog Number: orb80625
Product Properties
| Catalog Number | orb80625 |
|---|---|
| Category | Proteins |
| Description | Recombinant of Human TNFR2 protein (His Tag) |
| Form/Appearance | Sterile Filtered clear solution. |
| Buffer/Preservatives | TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT |
| Application notes | Cytokines And Growth Factors |
| Source | Escherichia Coli |
| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles |
| Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
| Note | For research use only |
Images
Similar Products
- Item 1 of 1
- Item 1 of 1
Human TNFRSF1B Protein, His Tag [orb1743294]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 26.0 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-His is approximately 35-55 kDa due to glycosylation.
E.coli
50 μg, 10 μg, 100 μg Recombinant Human TNFRSF1B Protein, His Tag [orb1551506]
≥90% as determined by SDS-PAGE
This protein contains the human TNFRSF1B(Pro24-Thr206) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μg
Reviews
Human TNFR2 Protein (His Tag) (orb80625)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review