You have no items in your shopping cart.
Cart summary
Human TNFR2 Protein (His Tag)
Catalog Number: orb80625
| Catalog Number | orb80625 |
|---|---|
| Category | Proteins |
| Description | Recombinant of Human TNFR2 protein (His Tag) |
| Form/Appearance | Sterile Filtered clear solution. |
| Buffer/Preservatives | TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT |
| Application notes | Cytokines And Growth Factors |
| Source | Escherichia Coli |
| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles |
| Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
| Note | For research use only |
- Item 1 of 1
Human TNFRSF1B Protein, His Tag [orb1743294]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 26.0 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-His is approximately 35-55 kDa due to glycosylation.
E.coli
50 μg, 100 μg, 10 μg - Item 1 of 1
Human TNFRSF1B Protein, Fc & His Tag [orb2697355]
> 95%, determined by SDS-PAGE
This protein contains (Met 1-Asp 257) of human TNFRII (NP_0010571) was fused with the C-terminal polyhistidine-tagged Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells.
50 μg, 1 mgHuman TNFRSF1B Protein, His Tag [orb2701532]
> 97%, determined by SDS-PAGE
This protein contains the extracellular domain (Met 1-Asp 257) of human TNFRII (NP_001057.1) was expressed from HEK293 Cells.
100 μg, 20 μgHuman TNFRSF1B Protein, His Tag [orb2701533]
> 95%, determined by SDS-PAGE
This protein contains the human TNFRSF1B (P20333-2) (Met1-Arg268, natural variant 196 Met/Arg) was expressed with a C-terminal polyhistidine tag.
100 μg, 50 μg
