You have no items in your shopping cart.
Human TNFR (His) Protein
SKU: orb428897
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered clear solution. |
| Buffer/Preservatives | TNFR His Tag protein is supplied in 1xPBS, 50% glycerol. |
| Disclaimer | For research use only |
Alternative Names
−Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.
Similar Products
−LTBR (NM_002342) Human Recombinant Protein [orb3033847]
> 80% as determined by SDS-PAGE and Coomassie blue staining
21.8 kDa
50 μg, 1 mgRecombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO [orb2963556]
>90% as determined by SDS-PAGE.
22.66 kDa
1 mg, 100 μg, 50 μgRecombinant Human CD357/TNFRSF18/GITR Protein, C-His [orb2964257]
>90% as determined by SDS-PAGE.
17.96 kDa
1 mg, 100 μg, 50 μgRecombinant Human CD120b/TNFRSF1B/TNFR2 Protein, N-His [orb2968973]
>90% as determined by SDS-PAGE.
27.44 kDa
1 mg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TNFR (His) Protein (orb428897)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review