You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 cells is 30-180pg/ml. |
| Tag | Tag-Free |
| Expression Region | 303-414aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 12.7 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Transforming growth factor beta-2;TGFB2;Polyergin;G-TSF;Glioblastoma-derived T-cell suppressor factor;Cetermin;BSC-1 cell growth inhibitor;TGF-beta-2
Similar Products
−- Item 1 of 4
TGFB2/TGF-beta-2 Human Monoclonal Antibody [orb2960367]
ELISA, FC, NeA
Human
Human
Monoclonal
Unconjugated
1 mg, 100 μg 
Recombinant Human TGF-beta 2 Protein (Biotin) [orb2993079]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 12.7&36 KDa. Observed: 13&39-50 KDa, reducing conditions
20 μg, 100 μgRecombinant Human TGF-beta 2 Protein (Biotin) [orb2993087]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 14.5 KDa. Observed: 10-14 KDa, reducing conditions
20 μg, 100 μg- Item 1 of 3
Human TGFB2 protein [orb418749]
Greater than 90% as determined by SDS-PAGE.
16.7 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 2
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks