Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human TGFB2 protein
Catalog Number orb428807
ReactivityHuman
ConjugationUnconjugated
Target TGFB2
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.
Purity >97.0% as determined by SDS-PAGE.
Source Nicotiana benthamiana.
Activity The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Product Description

Recombinant of human TGFB2 protein

Solubility (25°C)
Solubility (25°C) It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H2O not less than 1μg/40μl, which can then be further diluted to other aqueous solutions.
Reviews
Write Your Own Review
You're reviewing:Human TGFB2 protein - orb428807
Your Rating