Human TARC Protein

• Catalog Number: orb428735
• Category: Proteins
• Description: Recombinant of human TARC protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Purity: Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Solubility (25°C): It is recommended to reconstitute the lyophilized CCL17 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS
• Source: Escherichia Coli
• Biological Activity: Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
• Storage: Stability: Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TARC should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Buffer/Preservatives: The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.
• Alternative names: C-C motif chemokine 17, Small-inducible cytokine A
• Note: For research use only
• Application notes: Chemokines
• Expiration Date: 6 months from date of receipt.