Human TARC Protein

SKU: orb428735

Description

Recombinant of human TARC protein

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  Chemokines

Key Properties

• Source: Escherichia Coli
• Biological Activity: Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
• Purity: Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Protein Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS

Storage & Handling

• Storage: Stability: Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TARC should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273.