You have no items in your shopping cart.
Human TARC Protein
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg. |
| Protein Sequence | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS |
| Purity | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TARC should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human CCL17 protein (Active) [orb359045]
> 97% as determined by SDS-PAGE and HPLC.
8.1 kDa
E.Coli
5 μg, 100 μg, 500 μgCCL17 Antibody [orb412139]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 50 μl, 100 μl, 200 μlHuman CCL17 Protein, hFc Tag [orb2321411]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.2 kDa after removal of the signal peptide. The apparent molecular mass of CCL17-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgHuman CCL17 (C-6His) Protein [orb1471745]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
9.1 KDa
Mammalian
50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Request a Document
Protocol Information
Human TARC Protein (orb428735)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




