You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 27-274aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 56.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TACSTD2/TROP2 Human Monoclonal Antibody [orb2958445]
ELISA, FC, WB
Human
Human
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μgTACSTD2/TROP2 Mouse Monoclonal Antibody [orb2975404]
FC
Human
Mouse
Monoclonal
Unconjugated
50 μg, 100 μgRecombinant Human TROP-2 Protein [orb2993744]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 54.8 KDa. Observed: 60-80 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human TROP-2 Protein (Biotin) [orb2993745]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 30.5 KDa. Observed: 40-60 KDa, reducing conditions
20 μg, 100 μgRecombinant Human TROP-2 Protein [orb2994102]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 22.6 KDa. Observed: 28-40 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured in cell activity assay using U937 cells, the EC50 for this effect is 190.2-298.6 ng/ml.

The purity of TACSTD2 was greater than 95% as determined by SEC-HPLC
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human TACSTD2 protein (orb624117)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








