Human TACSTD2 protein

SKU: orb624117

Featured

Active

Description

This Human TACSTD2 protein spans the amino acid sequence from region 27-274aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

−

Item 1 of 3

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.
Tag	C-terminal hFc1-tagged
Molecular Weight	56.8 kDa
Expression Region	27-274aa
Protein Length	Partial
Protein Sequence	HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2)

Human Trop2 Protein, His Tag [orb1290911]

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 28.7 kDa after removal of the signal peptide. The apparent molecular mass of Trop2-His is approximately 35-40 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Item 1 of 2
Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active) [orb1674362]
Purity:
Greater than 95% as determined by SDS-PAGE.
MW:
30.6 kDa
Source:
Mammalian cell
Sizes Available: 1 mg, 100 μg
Item 1 of 2
Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active) [orb1674363]
Purity:
Greater than 95% as determined by SDS-PAGE.
MW:
30.3 kDa
Source:
Mammalian cell
Sizes Available: 1 mg, 100 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured in cell activity assay using U937 cells, the EC50 for this effect is 190.2-298.6 ng/ml.

The purity of TACSTD2 was greater than 95% as determined by SEC-HPLC

Quick Database Links

UniProt

P09758

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols