You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb418746 |
---|---|
Category | Proteins |
Description | Recombinant Human Sulfotransferase 1A3/1A4 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 50.2 kDa |
UniProt ID | P0DMM9 |
Protein Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Protein Length | Full Length |
Source | E.coli |
Expression System | Expression Region: 1-295aa. Protein Length: Full Length |
Expression Region | 1-295aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Aryl sulfotransferase 1A3/1A4 Catecholamine-sulfat Read more... |
Note | For research use only |
Application notes | Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-295aaSequence Info: Full Length |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
61.2 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
≥90% as determined by SDS-PAGE | |
This protein contains the human SULT1A3(Met1-Leu295) was fused with the N-terminal His Tag and expressed in E. coli. |
Filter by Rating