You have no items in your shopping cart.
Cart summary
Human SULT1A1 protein
Catalog Number: orb54222
| Catalog Number | orb54222 |
|---|---|
| Category | Proteins |
| Description | Recombinant human SULT1A1 protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 61.1 kDa |
| UniProt ID | P50225 |
| Protein Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
| Protein Length | Full Length of BC000923 |
| Source | E.coli |
| Expression System | Expression Region: 1-295aa. Protein Length: Full Length of BC000923 |
| Expression Region | 1-295aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Aryl sulfotransferase 1 HAST1/HAST2 Phenol sulfotr Read more... |
| Note | For research use only |
| Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-323AA: 1-295AAFull Length : Full Length of BC000923 |
| Expiration Date | 6 months from date of receipt. |
Human SULT1A1 protein [orb392529]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human SULT1A1 Protein, His Tag [orb1551450]
> 95% by SDS-PAGE.
KMP1037, Recombinant Human SULT1A1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu295) of human SULT1A1 (Accession #NP_001046.2) fused with a 6×His Tag at the C-terminus.
100 μg, 50 μgRecombinant Human SULT1A1 Protein, His Tag [orb1551594]
≥90% as determined by SDS-PAGE
This protein contains the human SULT1A1(Met1-Leu295) was fused with the N-terminal His Tag and expressed in E. coli.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars