You have no items in your shopping cart.
Cart summary
Human ST6GAL1 protein
Catalog Number: orb419251
| Catalog Number | orb419251 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 52.1 kDa |
| UniProt ID | P15907 |
| Protein Sequence | MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC |
| Protein Length | Full Length |
| Source | in vitro E.coli expression system |
| Expression System | Expression Region: 1-406aa. Protein Length: Full Length |
| Expression Region | 1-406aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | B-cell antigen CD75 CMP-N-acetylneuraminate-beta-g Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 6xHis-taggedExpression Region: 1-406aaSequence Info: Full Length |
| Expiration Date | 6 months from date of receipt. |
Human ST6GAL1 protein [orb392518]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human CD75/ST6GAL1 Protein, His Tag [orb1553381]
≥90% as determined by SDS-PAGE
This protein contains the human ST6GAL1(Lys27-Cys406) was fused with the N-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human ST6GAL1 Protein, His Tag [orb1551606]
≥90% as determined by SDS-PAGE
This protein contains the human ST6GAL1(Lys27-Cys406) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars