You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604387 |
---|---|
Category | Proteins |
Description | Recombinant Human Sepiapterin reductase(SPR) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 32 kDa |
UniProt ID | P35270 |
Protein Sequence | MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK |
Protein Length | Full Length |
Source | E.coli |
Expression System | Expression Region: 1-261aa. Protein Length: Full Length |
Expression Region | 1-261aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | OTTHUMP00000160199, SDR38C1, Sepiapterin reductase Read more... |
Note | For research use only |
Application notes | Full Length |
Expiration Date | 6 months from date of receipt. |
Biotin | |
95% | |
63.9 kDa | |
Biotinylated Human IL-18 R1, Fc, (orb1152438) is expressed from human 293 cells (HEK293). It contains AA Ala 19 - Arg 329 (Accession # AAH69575.1). |
Unconjugated | |
> 90% as determined by SDS-PAGE | |
29.4 kDa | |
Human FGF-5 Protein, His Tag (orb1818948) is expressed from E. coli cells. It contains AA Glu 23 - Gly 268 (Accession # P12034-1). |
Greater than 85% as determined by SDS-PAGE. | |
17.3 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
12 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
11.5 kDa | |
Yeast |
Filter by Rating