You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb705343 |
---|---|
Category | Proteins |
Description | Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial |
Tag | C-terminal hFc-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
Purity | Greater than 92% as determined by SDS-PAGE. |
Protein Sequence | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG |
Protein Length | Partial |
UniProt ID | Q8WVN6 |
MW | 41.6 kDa |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml. |
Expression Region | 29-145aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | (Protein K-12)(K12) |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.
Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay.
Greater than 85% as determined by SDS-PAGE. | |
41.6 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
13.8 kDa | |
Mammalian cell |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |