Human SECTM1 protein

SKU: orb705343

Description

This Human SECTM1 protein spans the amino acid sequence from region 29-145aa. Purity: Greater than 92% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.
• Tag: C-terminal hFc-tagged
• Molecular Weight: 41.6 kDa
• Expression Region: 29-145aa
• Protein Length: Partial
• Protein Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
• Purity: Greater than 92% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Disclaimer: For research use only

Alternative Names

(Protein K-12)(K12)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.

Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay.

Quick Database Links

UniProt

Q8WVN6