You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb705343 |
---|---|
Category | Proteins |
Description | Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial |
Tag | C-terminal hFc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 92% as determined by SDS-PAGE. |
MW | 41.6 kDa |
UniProt ID | Q8WVN6 |
Protein Sequence | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG |
Protein Length | Partial |
Source | Mammalian cell |
Expression System | Expression Region: 29-145aa. Protein Length: Partial |
Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml. |
Expression Region | 29-145aa |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Alternative names | (Protein K-12)(K12) Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
13.5 kDa | |
Human SECTM1, His Tag (orb257831) is expressed from human 293 cells (HEK293). It contains AA Gln 29 - Gly 145 (Accession # AAH17716). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Greater than 90% as determined by SDS-PAGE. | |
13.8 kDa | |
Mammalian cell |
Filter by Rating